Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Coagulation factor III/F3, Human (HEK293, Fc)

Coagulation factor III/F3 Protein, Human (HEK293, Fc) is a recombinant human CD142 expressed in HEK 293 cells with a Fc tag at the C-terminus. Coagulation Factor III/CD142 Protein is a principal regulator of oncogenic neoangiogenesis and controls therefore the cancerous process.

Product Specifications

Product Name Alternative

Coagulation factor III/F3 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tissue-factor-protein-human-hek293-fc.html

Purity

95.0

Smiles

SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE

Molecular Formula

2152 (Gene_ID) P13726-1 (S33-G251) (Accession)

Molecular Weight

65-72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-ROS (Tyr2274) Antibody
MBS9614187-01 0.05 mL

Phospho-ROS (Tyr2274) Antibody

Sign In for Pricing
View Details
Phospho-ROS (Tyr2274) Antibody
MBS9614187-02 0.1 mL

Phospho-ROS (Tyr2274) Antibody

Sign In for Pricing
View Details
Phospho-ROS (Tyr2274) Antibody
MBS9614187-03 0.2 mL

Phospho-ROS (Tyr2274) Antibody

Sign In for Pricing
View Details
Phospho-ROS (Tyr2274) Antibody
MBS9614187-04 5x 0.2 mL

Phospho-ROS (Tyr2274) Antibody

Sign In for Pricing
View Details
Human F2RL3 Protein, hFc Tag
MBS189546-01 0.01 mg

Human F2RL3 Protein, hFc Tag

Sign In for Pricing
View Details
Human F2RL3 Protein, hFc Tag
MBS189546-02 0.05 mg

Human F2RL3 Protein, hFc Tag

Sign In for Pricing
View Details