Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Viral interleukin-10 homolog (BCRF1)

Product Specifications

Product Name Alternative

20 kDa protein (Protein BCRF1) (vIL-10)

Abbreviation

Recombinant Epstein-Barr virus BCRF1 protein

Gene Name

BCRF1

UniProt

P03180

Expression Region

24-170aa

Organism

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Target Sequence

TDQCDNFPQMLRDLRDAFSRVKTFFQTKDEVDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPEAKDHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQIKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTIKAR

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Plays a role in masking infected cells for immune recognition by cytotoxic T-lymphocytes. Down-regulates the expression of the host TAP1 gene, thereby affecting the transport of peptides into the endoplasmic reticulum and subsequent peptide loading by MHC class I molecules. Inhibits IFN-gamma synthesis.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

24.8 kDa

References & Citations

"Homology of cytokine synthesis inhibitory factor (IL-10) to the Epstein-Barr virus gene BCRFI." Moore K.W., Vieira P., Fiorentino D.F., Trounstine M.L., Khan T.A., Mosmann T.R. Science 248:1230-1234 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc6a8 Mouse qPCR Primer Pair (NM_133987)
MP215926 200 Reactions

Slc6a8 Mouse qPCR Primer Pair (NM_133987)

Sign In for Pricing
View Details
ATXN7 Protein Vector (Human) (pPM-N-D-C-HA)
PV325704 500 ng

ATXN7 Protein Vector (Human) (pPM-N-D-C-HA)

Sign In for Pricing
View Details
Vial tray, for LyoPilot D12S, optional
FD1107 1 Each

Vial tray, for LyoPilot D12S, optional

Sign In for Pricing
View Details
ANKRD15 (KN Motif and Ankyrin Repeat Domain-containing Protein 1, Ankyrin Repeat Domain-containing Protein 15, Kidney Ankyrin Repeat-containing Protein, KANK1, KANK, KIAA0172) (MaxLight 490)
MBS6199535-01 0.1 mL

ANKRD15 (KN Motif and Ankyrin Repeat Domain-containing Protein 1, Ankyrin Repeat Domain-containing Protein 15, Kidney Ankyrin Repeat-containing Protein, KANK1, KANK, KIAA0172) (MaxLight 490)

Sign In for Pricing
View Details
ANKRD15 (KN Motif and Ankyrin Repeat Domain-containing Protein 1, Ankyrin Repeat Domain-containing Protein 15, Kidney Ankyrin Repeat-containing Protein, KANK1, KANK, KIAA0172) (MaxLight 490)
MBS6199535-02 5x 0.1 mL

ANKRD15 (KN Motif and Ankyrin Repeat Domain-containing Protein 1, Ankyrin Repeat Domain-containing Protein 15, Kidney Ankyrin Repeat-containing Protein, KANK1, KANK, KIAA0172) (MaxLight 490)

Sign In for Pricing
View Details
Olfr994 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4219308 1.0 µg DNA

Olfr994 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details