Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCIP-1, Mouse (P.pastoris, His)

KCIP-1 protein serves as the linker of TNFRSF1A/TNFR1 and mediates its interaction with FADD. Overexpression induces TNF-induced responses: apoptosis and NF-κ-B activation. KCIP-1 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived KCIP-1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

KCIP-1 Protein, Mouse (P.pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kcip-1-protein-mouse-p-pastoris-his.html

Purity

95.0

Smiles

MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLILNATQAESKVFYLKMKGDYFRYLSEVASGENKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Molecular Formula

54401 (Gene_ID) Q9CQV8-1 (M1-N246) (Accession)

Molecular Weight

Approximately 33 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (1415-1), CF568 conjugate, 0.1mg/mL
BNC680580-100 1x 100 µL

Histone H1 (1415-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PKMYT1 (NM_004203) Human Recombinant Protein
TP322657 20 µg

PKMYT1 (NM_004203) Human Recombinant Protein

Sign In for Pricing
View Details
Low Temperature Kinematic Viscometer BPTL-107
BPTL-107 1 Unit

Low Temperature Kinematic Viscometer BPTL-107

Sign In for Pricing
View Details
DCTD (NM_001012732) Human Over-expression Lysate
LY422825 100 µg

DCTD (NM_001012732) Human Over-expression Lysate

Sign In for Pricing
View Details
CD47 (IAP/964 + B6H12.2), CF405S conjugate, 0.1mg/mL
BNC041029-100 1x 100 µL

CD47 (IAP/964 + B6H12.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TentaGel® MB FMP
MB160160.5G 5 g

TentaGel® MB FMP

Sign In for Pricing
View Details