Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCIP-1, Mouse (P.pastoris, His)

KCIP-1 protein serves as the linker of TNFRSF1A/TNFR1 and mediates its interaction with FADD. Overexpression induces TNF-induced responses: apoptosis and NF-κ-B activation. KCIP-1 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived KCIP-1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

KCIP-1 Protein, Mouse (P.pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kcip-1-protein-mouse-p-pastoris-his.html

Purity

95.0

Smiles

MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLILNATQAESKVFYLKMKGDYFRYLSEVASGENKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Molecular Formula

54401 (Gene_ID) Q9CQV8-1 (M1-N246) (Accession)

Molecular Weight

Approximately 33 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC100129697 (NM_001290330) Human Tagged ORF Clone
RG238075 10 µg

LOC100129697 (NM_001290330) Human Tagged ORF Clone

Sign In for Pricing
View Details
Centrifuge Tubes
C2601-B 500 Units/Case

Centrifuge Tubes

Sign In for Pricing
View Details
Cytochrome P450 3A1 / CYP3A1 (P6), Biotin conjugate, 0.1mg/mL
BNCB3058-100 1x 100 µL

Cytochrome P450 3A1 / CYP3A1 (P6), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human QSOX2 activation kit by CRISPRa
GA116191 1 Kit

Human QSOX2 activation kit by CRISPRa

Sign In for Pricing
View Details
Phenethylamine
TRC-P321335-25G 25 g

Phenethylamine

Sign In for Pricing
View Details
TXNL1 Polyclonal Antibody
E-AB-61887-01 60 µL

TXNL1 Polyclonal Antibody

Sign In for Pricing
View Details