KCIP-1, Mouse (P.pastoris, His)
KCIP-1 protein serves as the linker of TNFRSF1A/TNFR1 and mediates its interaction with FADD. Overexpression induces TNF-induced responses: apoptosis and NF-κ-B activation. KCIP-1 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived KCIP-1 protein, expressed by P. pastoris , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
KCIP-1 Protein, Mouse (P.pastoris, His), Mouse, P. pastoris
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/kcip-1-protein-mouse-p-pastoris-his.html
Purity
95.0
Smiles
MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLILNATQAESKVFYLKMKGDYFRYLSEVASGENKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN
Molecular Formula
54401 (Gene_ID) Q9CQV8-1 (M1-N246) (Accession)
Molecular Weight
Approximately 33 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb6050-02 100 µL
Phospho-FoxO1 (Ser256) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details orb6050-03 200 µL
Phospho-FoxO1 (Ser256) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details bs-12526R-BF594 100 µL
ARPC1A Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
Sign In for Pricing
View Details 
MBS1357306-01 0.02 mg (E-Coli)
Recombinant Staphylococcus aureus Pyrrolidone-carboxylate peptidase (pcp)
Sign In for Pricing
View Details