Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human papillomavirus type 16 protein E4 (E4)

Product Specifications

Product Name Alternative

E1^E4

Abbreviation

Recombinant Human papillomavirus type 16 E4 protein

Gene Name

E4

UniProt

P06922

Expression Region

1-92aa

Organism

Human papillomavirus type 16

Target Sequence

MADPAAATKYPLLKLLGSTWPTTPPRPIPKPSPWAPKKHRRLSSDQDQSQTPETPATPLSCCTETQWTVLQSSLHLTAHTKDGLTVIVTLHP

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Contributes to multiple aspects of the viral life cycle including viral genome amplification, suppression of suprabasal cell differentiation and egress of newly formed virions. Induces host cell cycle arrest at the G2 phase by associating with and preventing the nuclear entry of host CDK1/cyclin B1 complexes. Inhibits cellular DNA replication by preventing loading of host replication licensing proteins MCM2 and MCM7 onto chromatin. Within the cytoplasm, associates with host kinase SRPK1, a splicing factor regulator, and inhibits its activity. Therefore, E4 favors expression of late viral transcripts by inhibiting SRPK1-mediated phosphorylation of host serine-arginine proteins that have critical roles in mRNA metabolism. Late in the infectious cycle, E4 also acts to diminish the integrity of the keratinocyte by disrupting the keratin cytoskeleton and inducing apoptosis through alteration of mitochondrial function to facilitate egress of the newly formed virions.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.5 kDa

References & Citations

"Phosphorylation of the human papillomavirus type 16 E1--E4 protein at T57 by ERK triggers a structural change that enhances keratin binding and protein stability." Wang Q., Kennedy A., Das P., McIntosh P.B., Howell S.A., Isaacson E.R., Hinz S.A., Davy C., Doorbar J. J. Virol. 83:3668-3683 (2009)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chlorprothixene hydrochloride
MBS3605451-01 25 mg

Chlorprothixene hydrochloride

Sign In for Pricing
View Details
Chlorprothixene hydrochloride
MBS3605451-02 50 mg

Chlorprothixene hydrochloride

Sign In for Pricing
View Details
Chlorprothixene hydrochloride
MBS3605451-03 100 mg

Chlorprothixene hydrochloride

Sign In for Pricing
View Details
Chlorprothixene hydrochloride
MBS3605451-04 200 mg

Chlorprothixene hydrochloride

Sign In for Pricing
View Details
Chlorprothixene hydrochloride
MBS3605451-05 5x 200 mg

Chlorprothixene hydrochloride

Sign In for Pricing
View Details
Mef2b 3'UTR Luciferase Stable Cell Line
TU113072 1.0 mL

Mef2b 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details