Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRO-alpha/CXCL1, Human (HEK293, His)

CXCL1 (Chemokine (C-X-C motif) ligand 1), also known as GRO alpha, NAP-3 or MGSA, belongs to the sub-family of CXC chemokine. CXCL1 is involved in the development of many inflammatory diseases, including the induction of angiogenesis and recruitment of neutrophils. CXCL1 is produced by many cell types, and activates CXCR2 and, at high levels, CXCR1[1]. GRO-alpha/CXCL1 Protein, Human (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag. It consists of 73 amino acids (A35-N107) .

Product Specifications

Product Name Alternative

GRO-alpha/CXCL1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gro-alpha-cxcl1-protein-human-hek-293-his.html

Purity

95.00

Smiles

ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

Molecular Formula

2919 (Gene_ID) P09341 (A35-N107) (Accession)

Molecular Weight

Approximately 9-14 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Giovanna Vella, et al. The IL-17 receptor IL-17RE mediates polyIC-induced exacerbation of experimental allergic asthma. Respir Res. 2020 Jul 8;21 (1) :176.|[2]Jasper F Nies, et al. IL-17C/IL-17RE: Emergence of a Unique Axis in TH17 Biology. Front Immunol. 2020 Feb 26;11:341.|[3]Xinyang Song, et al. IL-17RE is the functional receptor for IL-17C and mediates mucosal immunity to infection with intestinal pathogens. Nat Immunol. 2011 Oct 12;12 (12) :1151-8.|[4]Caini Liu, et al. The flavonoid cyanidin blocks binding of the cytokine interleukin-17A to the IL-17RA subunit to alleviate inflammation in vivo. Sci Signal. 2017 Feb 21;10 (467) :eaaf8823.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL
BNC680031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF647 conjugate, 0.1mg/mL
BNC472216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL
BNC741231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF594 conjugate, 0.1mg/mL
BNC940977-100 1x 100 µL

TGF-beta (1D11.16.8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF555 conjugate, 0.1mg/mL
BNC550039-500 1x 500 µL

CD34 (ICO-115), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF555 conjugate, 0.1mg/mL
BNC551052-500 1x 500 µL

CD3e (B-B12), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details