GRO-alpha/CXCL1, Human (HEK293, His)
CXCL1 (Chemokine (C-X-C motif) ligand 1), also known as GRO alpha, NAP-3 or MGSA, belongs to the sub-family of CXC chemokine. CXCL1 is involved in the development of many inflammatory diseases, including the induction of angiogenesis and recruitment of neutrophils. CXCL1 is produced by many cell types, and activates CXCR2 and, at high levels, CXCR1[1]. GRO-alpha/CXCL1 Protein, Human (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag. It consists of 73 amino acids (A35-N107) .
Product Specifications
Product Name Alternative
GRO-alpha/CXCL1 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gro-alpha-cxcl1-protein-human-hek-293-his.html
Purity
95.00
Smiles
ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
Molecular Formula
2919 (Gene_ID) P09341 (A35-N107) (Accession)
Molecular Weight
Approximately 9-14 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
(D-Lys (nicotinoyl) 1, b- (3-pyridyl) -Ala3,3,4-dichloro-D-Phe5, Asn6, D-Trp7·9, Nle 11) -Substance P trifluoroacetate salt
(D-Lys (nicotinoyl) 1, b- (3-pyridyl) -Ala3,3,4-dichloro-D-Phe5, Asn6, D-Trp7·9, Nle 11) -Substance P trifluoroacetate salt
(D-Lys (nicotinoyl) 1, b- (3-pyridyl) -Ala3,3,4-dichloro-D-Phe5, Asn6, D-Trp7·9, Nle 11) -Substance P trifluoroacetate salt
