Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDA2R/XEDAR, Human (HEK293, His)

The EDA2R/XEDAR protein acts as a receptor for the EDA isoform A2 (unlike A1) and is critical for activating the NF-kappa-B and JNK pathways. Its activation involves binding to TRAF3 and TRAF6. EDA2R/XEDAR Protein, Human (HEK293, His) is the recombinant human-derived EDA2R/XEDAR protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

EDA2R/XEDAR Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eda2r-xedar-protein-human-hek293-his.html

Purity

95.0

Smiles

MDCQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHRCQSCITCAVINRVQKVNCTATSNAVCGDCLPRFYRKTRIGGLQDQECIPCTKQTPTSEVQCAFQLSLVEADTPTVPPQEA

Molecular Formula

60401 (Gene_ID) Q9HAV5 (M1-T138) (Accession)

Molecular Weight

Approximately 23-25 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aquaporin 2 (AQP2) Antibody
abx214861-01 50 µL

Aquaporin 2 (AQP2) Antibody

Sign In for Pricing
View Details
Aquaporin 2 (AQP2) Antibody
abx214861-02 100 µL

Aquaporin 2 (AQP2) Antibody

Sign In for Pricing
View Details
Culture Medium for Human Pancreatic Adenocarcinoma Cells [AsPC-1]
AFG-ELL-1243-01 125 mL

Culture Medium for Human Pancreatic Adenocarcinoma Cells [AsPC-1]

Sign In for Pricing
View Details
Culture Medium for Human Pancreatic Adenocarcinoma Cells [AsPC-1]
AFG-ELL-1243-02 500 mL

Culture Medium for Human Pancreatic Adenocarcinoma Cells [AsPC-1]

Sign In for Pricing
View Details
EF-1β Antibody
OM636491-01 100 µL

EF-1β Antibody

Sign In for Pricing
View Details
EF-1β Antibody
OM636491-02 20 µL

EF-1β Antibody

Sign In for Pricing
View Details