Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF-alpha/TNFSF2, Equine

TNF-alpha/TNFSF2 protein binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It induces tumor cell death, fever, cachexia, cell proliferation, and cell differentiation. It also causes insulin resistance and GKAP42 protein degradation in adipocytes. Additionally, it plays a role in angiogenesis, osteoclastogenesis, and IL12 production in dendritic cells. TNF-alpha/TNFSF2 Protein, Equine is the recombinant equine-derived TNF-alpha/TNFSF2 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

TNF-alpha/TNFSF2 Protein, Equine, Equine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnf-alpha-tnfsf2-protein-equine.html

Purity

95.0

Smiles

LRSSSRTPSDKPVAHVVANPQAEGQLQWLSGRANALLANGVKLTDNQLVVPLDGLYLIYSQVLFKGQGCPSTHVLLTHTISRLAVSYPSKVNLLSAIKSPCHTESPEQAEAKPWYEPIYLGGVFQLEKGDQLSAEINQPNYLDFAESGQVYFGIIAL

Molecular Formula

100033834 (Gene_ID) NP_001075288 (L78-L234) (Accession)

Molecular Weight

Approximately 19.36 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPINK7 Human Gene Knockout Kit (CRISPR)
KN418867 1 Kit

SPINK7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Hepatitis B Virus,  30nm
GM-602-30 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Hepatitis B Virus, 30nm

Sign In for Pricing
View Details
SIAH Interacting Protein (CACYBP) Mouse Monoclonal Antibody [Clone ID: AT3G8]
AM50340PU-S 50 µL

SIAH Interacting Protein (CACYBP) Mouse Monoclonal Antibody [Clone ID: AT3G8]

Sign In for Pricing
View Details
LARGE (LARGE1) Human Gene Knockout Kit (CRISPR)
KN217876LP 1 Kit

LARGE (LARGE1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1-Bromo-3-ethylbenzene
TRC-B685840-2.5G 2.5 g

1-Bromo-3-ethylbenzene

Sign In for Pricing
View Details
all-trans-Retinoic Acid
TRC-R250200-50MG 50 mg

all-trans-Retinoic Acid

Sign In for Pricing
View Details