Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF-alpha/TNFSF2, Equine

TNF-alpha/TNFSF2 protein binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It induces tumor cell death, fever, cachexia, cell proliferation, and cell differentiation. It also causes insulin resistance and GKAP42 protein degradation in adipocytes. Additionally, it plays a role in angiogenesis, osteoclastogenesis, and IL12 production in dendritic cells. TNF-alpha/TNFSF2 Protein, Equine is the recombinant equine-derived TNF-alpha/TNFSF2 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

TNF-alpha/TNFSF2 Protein, Equine, Equine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnf-alpha-tnfsf2-protein-equine.html

Purity

95.0

Smiles

LRSSSRTPSDKPVAHVVANPQAEGQLQWLSGRANALLANGVKLTDNQLVVPLDGLYLIYSQVLFKGQGCPSTHVLLTHTISRLAVSYPSKVNLLSAIKSPCHTESPEQAEAKPWYEPIYLGGVFQLEKGDQLSAEINQPNYLDFAESGQVYFGIIAL

Molecular Formula

100033834 (Gene_ID) NP_001075288 (L78-L234) (Accession)

Molecular Weight

Approximately 19.36 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Galectin 3 Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-61087R-BF350-01 20 µL

Galectin 3 Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Galectin 3 Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-61087R-BF350-02 100 µL

Galectin 3 Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
PCNA Rabbit Polyclonal Antibody
53563-01 50 µL

PCNA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PCNA Rabbit Polyclonal Antibody
53563-02 100 µL

PCNA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CaMKII, phosphorylated (Thr286)
592348 100 µL

CaMKII, phosphorylated (Thr286)

Sign In for Pricing
View Details
Anti-CD19_CD20-ScFv-4-1BB-CD3ζ (Puro) Lentivirus
LVP1642 1x 10^8 IFU/mL - 200 μL

Anti-CD19_CD20-ScFv-4-1BB-CD3ζ (Puro) Lentivirus

Sign In for Pricing
View Details