Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTM2, Human (His)

GSTM2 protein is pivotal in conjugating reduced glutathione to diverse hydrophobic electrophiles and actively participates in synthesizing hepoxilin regioisomers, as documented. This underscores GSTM2's multifunctional nature, emphasizing its role in detoxification and forming unique molecular species, contributing to the broader cellular response to various electrophilic compounds. GSTM2 Protein, Human (His) is the recombinant human-derived GSTM2, expressed by E. coli, with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GSTM2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gstm2-protein-human-n-his.html

Purity

98.0

Smiles

MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK

Molecular Formula

2946 (Gene_ID) P28161-1 (M1-K218) (Accession)

Molecular Weight

Approximately 26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSH6 Antibody
8C13091-AAT 50 µg

MSH6 Antibody

Sign In for Pricing
View Details
DNAJC30 Human Gene Knockout Kit (CRISPR)
KN402958 1 Kit

DNAJC30 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Reptin Antibody
RC-15611-01 50 μL

Recombinant Reptin Antibody

Sign In for Pricing
View Details
Recombinant Reptin Antibody
RC-15611-02 100 µL

Recombinant Reptin Antibody

Sign In for Pricing
View Details
Recombinant Reptin Antibody
RC-15611-03 1 mL

Recombinant Reptin Antibody

Sign In for Pricing
View Details
Meprin alpha (MEP1A) Human Gene Knockout Kit (CRISPR)
KN424163 1 Kit

Meprin alpha (MEP1A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details