Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTM2, Human (His)

GSTM2 protein is pivotal in conjugating reduced glutathione to diverse hydrophobic electrophiles and actively participates in synthesizing hepoxilin regioisomers, as documented. This underscores GSTM2's multifunctional nature, emphasizing its role in detoxification and forming unique molecular species, contributing to the broader cellular response to various electrophilic compounds. GSTM2 Protein, Human (His) is the recombinant human-derived GSTM2, expressed by E. coli, with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GSTM2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gstm2-protein-human-n-his.html

Purity

98.0

Smiles

MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK

Molecular Formula

2946 (Gene_ID) P28161-1 (M1-K218) (Accession)

Molecular Weight

Approximately 26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse SerpinI1/Neuroserpin Protein (His Tag)
PKSM040434 50 µg

Recombinant Mouse SerpinI1/Neuroserpin Protein (His Tag)

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS624652 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Recombinant Mouse GDNF protein (N-His)
PKSM041512-01 20 µg

Recombinant Mouse GDNF protein (N-His)

Sign In for Pricing
View Details
Recombinant Mouse GDNF protein (N-His)
PKSM041512-02 100 µg

Recombinant Mouse GDNF protein (N-His)

Sign In for Pricing
View Details
Recombinant Human CD80 Protein (Fc Tag)
PDMH100265-01 20 µg

Recombinant Human CD80 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human CD80 Protein (Fc Tag)
PDMH100265-02 100 µg

Recombinant Human CD80 Protein (Fc Tag)

Sign In for Pricing
View Details