Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTM2, Human (His)

GSTM2 protein is pivotal in conjugating reduced glutathione to diverse hydrophobic electrophiles and actively participates in synthesizing hepoxilin regioisomers, as documented. This underscores GSTM2's multifunctional nature, emphasizing its role in detoxification and forming unique molecular species, contributing to the broader cellular response to various electrophilic compounds. GSTM2 Protein, Human (His) is the recombinant human-derived GSTM2, expressed by E. coli, with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GSTM2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gstm2-protein-human-n-his.html

Purity

98.0

Smiles

MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK

Molecular Formula

2946 (Gene_ID) P28161-1 (M1-K218) (Accession)

Molecular Weight

Approximately 26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lecithin (Technical Grade)
TRC-L320050-250MG 250 mg

Lecithin (Technical Grade)

Sign In for Pricing
View Details
Prostate Specific Antigen (KLK3) Mouse Monoclonal Antibody [Clone ID: AT1D10]
AM50013PU-S 50 µL

Prostate Specific Antigen (KLK3) Mouse Monoclonal Antibody [Clone ID: AT1D10]

Sign In for Pricing
View Details
CNBP Mouse Monoclonal Antibody [Clone ID: AT38F10]
AM50047PU-N 100 µL

CNBP Mouse Monoclonal Antibody [Clone ID: AT38F10]

Sign In for Pricing
View Details
OR52L1 Human Gene Knockout Kit (CRISPR)
KN420605 1 Kit

OR52L1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human nkx6.2 (NKX6-2) activation kit by CRISPRa
GA113571 1 Kit

Human nkx6.2 (NKX6-2) activation kit by CRISPRa

Sign In for Pricing
View Details
B4galnt4 Mouse Gene Knockout Kit (CRISPR)
KN501934 1 Kit

B4galnt4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details