Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTM2, Human (His)

GSTM2 protein is pivotal in conjugating reduced glutathione to diverse hydrophobic electrophiles and actively participates in synthesizing hepoxilin regioisomers, as documented. This underscores GSTM2's multifunctional nature, emphasizing its role in detoxification and forming unique molecular species, contributing to the broader cellular response to various electrophilic compounds. GSTM2 Protein, Human (His) is the recombinant human-derived GSTM2, expressed by E. coli, with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GSTM2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gstm2-protein-human-n-his.html

Purity

98.0

Smiles

MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK

Molecular Formula

2946 (Gene_ID) P28161-1 (M1-K218) (Accession)

Molecular Weight

Approximately 26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N WASP (WASL) Human Gene Knockout Kit (CRISPR)
KN207967LP 1 Kit

N WASP (WASL) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Colloidal Gold Conjugated Helix aspersa Lectin (Garden Snail) -HAA-,  20nm
GP-3801-20 1 mL

Colloidal Gold Conjugated Helix aspersa Lectin (Garden Snail) -HAA-, 20nm

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/3230), CF405S conjugate, 0.1mg/mL
BNC043230-100 1x 100 µL

Prohibitin (Mitochondrial Marker) (PHB/3230), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (rVWF/2480), CF405S conjugate, 0.1mg/mL
BNC043607-500 1x 500 µL

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (rVWF/2480), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: right
CS633280 5x 5 µm

Frozen Tissue Sections, Ovary: right

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS625519 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details