Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTM2, Human (His)

GSTM2 protein is pivotal in conjugating reduced glutathione to diverse hydrophobic electrophiles and actively participates in synthesizing hepoxilin regioisomers, as documented. This underscores GSTM2's multifunctional nature, emphasizing its role in detoxification and forming unique molecular species, contributing to the broader cellular response to various electrophilic compounds. GSTM2 Protein, Human (His) is the recombinant human-derived GSTM2, expressed by E. coli, with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GSTM2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gstm2-protein-human-n-his.html

Purity

98.0

Smiles

MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK

Molecular Formula

2946 (Gene_ID) P28161-1 (M1-K218) (Accession)

Molecular Weight

Approximately 26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E2F-8 shRNA Plasmid (h)
sc-96849-SH 20 µg

E2F-8 shRNA Plasmid (h)

Sign In for Pricing
View Details
EGFR (Epidermal Growth Factor Receptor, ERBB, ERBB1, HER1, PIG61, MENA) (FITC)
MBS6415191-01 0.1 mL

EGFR (Epidermal Growth Factor Receptor, ERBB, ERBB1, HER1, PIG61, MENA) (FITC)

Sign In for Pricing
View Details
EGFR (Epidermal Growth Factor Receptor, ERBB, ERBB1, HER1, PIG61, MENA) (FITC)
MBS6415191-02 5x 0.1 mL

EGFR (Epidermal Growth Factor Receptor, ERBB, ERBB1, HER1, PIG61, MENA) (FITC)

Sign In for Pricing
View Details
Mouse Monoclonal IFN-gamma Antibody (25718) [Alexa Fluor 350]
FAB285U 0.1 mL

Mouse Monoclonal IFN-gamma Antibody (25718) [Alexa Fluor 350]

Sign In for Pricing
View Details
DDX17 (NM_006386) Human Tagged ORF Clone
RC200599 10 µg

DDX17 (NM_006386) Human Tagged ORF Clone

Sign In for Pricing
View Details
PWS-PK-3 Adhesive-backed Marker Combination Packs
035553 450 Pack (45 Label (s) x 10 Sheet)

PWS-PK-3 Adhesive-backed Marker Combination Packs

Sign In for Pricing
View Details