Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Growth/differentiation factor 8 (MSTN)

Product Specifications

Product Name Alternative

(GDF-8) (Myostatin)

Abbreviation

Recombinant Dog MSTN protein

Gene Name

MSTN

UniProt

Q6UKZ8

Expression Region

267-375aa

Organism

Canis lupus familiaris (Dog) (Canis familiaris)

Target Sequence

DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Acts specifically as a negative regulator of skeletal muscle growth.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

16.5 kDa

References & Citations

"Cloning and characterization of canine myostatin (MSTN) ." Perkins K.J., Khurana T.S. Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Manidipine Dihydrochloride
TRC-M164015-25MG 25 mg

Manidipine Dihydrochloride

Sign In for Pricing
View Details
Rtn1 Mouse Gene Knockout Kit (CRISPR)
KN515188 1 Kit

Rtn1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4-Amino Levamisole Dihydrochloride
TRC-A611775-50MG 50 mg

4-Amino Levamisole Dihydrochloride

Sign In for Pricing
View Details
FADD Rabbit Polyclonal Antibody
AP06388PU-N 100 µg

FADD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human SPANXN3 activation kit by CRISPRa
GA115325 1 Kit

Human SPANXN3 activation kit by CRISPRa

Sign In for Pricing
View Details
Creatine kinase B type Recombinant Rabbit monoclonal Antibody
HA751286 100 µL

Creatine kinase B type Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details