Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MGL2/CD301b, Mouse (HEK293, His)

MGL2/CD301b is a type II lectin commonly used as a marker for alternatively activated macrophages. MGL2 can bind to terminal GalNAc residues, including the Tn antigen (GalNAc-αThr/Ser) . MGL2 is mainly expressed on immature, tolerogenic or type-2 DCs and alternatively-activated macrophages[1][2]. MGL2/CD301b Protein, Mouse (HEK293, His) is the recombinant mouse-derived MGL2/CD301b protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MGL2/CD301b Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mgl2-cd301b-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

SQNSQLRRDLGTLRAILDNTTSKIKAEFQSLDSRADNFEKGISSLKVDVEDHRQELQAGRDLSQKVTSLESTLEKREQALKTDLSDLTDHVQQLETDLKALTCQLANLKNNGSEVACCPLHWTEHEGSCYWFSESEKSWPEADKYCRLENSHLVVVNSLEEQNFLQNRLANVLSWMGLTDQNGPWRWVDGTDFDKGFKNWRPLQPDNWHGHMLGGGEDCAHFSYDGRWNDDVCQRHYHWICETELGKASSAHSPQLIASVP

Molecular Formula

216864 (Gene_ID) Q8JZN1 (S72-P332) (Accession)

Molecular Weight

30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Glutamine Synthetase Antibody (OTI1F4) [DyLight 405]
NBP2-70834V 0.1 mL

Mouse Monoclonal Glutamine Synthetase Antibody (OTI1F4) [DyLight 405]

Sign In for Pricing
View Details
Human TNFSF10 Protein
E40KMPH1570 20 µg

Human TNFSF10 Protein

Sign In for Pricing
View Details
Gdpd5 Mouse siRNA Oligo Duplex (Locus ID 233552)
SR427264 1 Kit

Gdpd5 Mouse siRNA Oligo Duplex (Locus ID 233552)

Sign In for Pricing
View Details
Mouse Glycated Hemoglobin A1c ELISA Kit (HbA1c)
RK02881 96 Tests

Mouse Glycated Hemoglobin A1c ELISA Kit (HbA1c)

Sign In for Pricing
View Details
Anti-Angiopoietin Like Protein 6 (ANGPTL6) Polyclonal antibody
FY-AB33825-01 1 mL

Anti-Angiopoietin Like Protein 6 (ANGPTL6) Polyclonal antibody

Sign In for Pricing
View Details
Anti-Angiopoietin Like Protein 6 (ANGPTL6) Polyclonal antibody
FY-AB33825-02 100 µL

Anti-Angiopoietin Like Protein 6 (ANGPTL6) Polyclonal antibody

Sign In for Pricing
View Details