Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MGL2/CD301b, Mouse (HEK293, His)

MGL2/CD301b is a type II lectin commonly used as a marker for alternatively activated macrophages. MGL2 can bind to terminal GalNAc residues, including the Tn antigen (GalNAc-αThr/Ser) . MGL2 is mainly expressed on immature, tolerogenic or type-2 DCs and alternatively-activated macrophages[1][2]. MGL2/CD301b Protein, Mouse (HEK293, His) is the recombinant mouse-derived MGL2/CD301b protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MGL2/CD301b Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mgl2-cd301b-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

SQNSQLRRDLGTLRAILDNTTSKIKAEFQSLDSRADNFEKGISSLKVDVEDHRQELQAGRDLSQKVTSLESTLEKREQALKTDLSDLTDHVQQLETDLKALTCQLANLKNNGSEVACCPLHWTEHEGSCYWFSESEKSWPEADKYCRLENSHLVVVNSLEEQNFLQNRLANVLSWMGLTDQNGPWRWVDGTDFDKGFKNWRPLQPDNWHGHMLGGGEDCAHFSYDGRWNDDVCQRHYHWICETELGKASSAHSPQLIASVP

Molecular Formula

216864 (Gene_ID) Q8JZN1 (S72-P332) (Accession)

Molecular Weight

30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fast Corinth V Salt
TRC-F103330-500MG 500 mg

Fast Corinth V Salt

Sign In for Pricing
View Details
HPA1 (A-7)
sc-518150 200 µg/mL

HPA1 (A-7)

Sign In for Pricing
View Details
Human Exostoses 1 (EXT1) ELISA Kit
orb1666542-01 48 Tests

Human Exostoses 1 (EXT1) ELISA Kit

Sign In for Pricing
View Details
Human Exostoses 1 (EXT1) ELISA Kit
orb1666542-02 96 Tests

Human Exostoses 1 (EXT1) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Cbl-c Antibody (01) [PerCP]
NBP3-06621PCP 0.1 mL

Mouse Monoclonal Cbl-c Antibody (01) [PerCP]

Sign In for Pricing
View Details
Dnal1 Mouse siRNA Oligo Duplex (Locus ID 105000)
SR403129 1 Kit

Dnal1 Mouse siRNA Oligo Duplex (Locus ID 105000)

Sign In for Pricing
View Details