Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A6, Mouse

The S100A6 protein binds calcium and zinc ions and acts as a multifunctional regulator. Its presence in the extracellular matrix suggests its involvement in extracellular processes. S100A6 Protein, Mouse is the recombinant mouse-derived S100A6 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

S100A6 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a6-protein-mouse.html

Purity

95.00

Smiles

MACPLDQAIGLLVAIFHKYSGKEGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMDDLDRNKDQEVNFQEYVAFLGALALIYNEALK

Molecular Formula

20200 (Gene_ID) NP_035443.1 (M1-K89) (Accession)

Molecular Weight

Approximately 10 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-INF2 Antibody Picoband® Fluoro647 Conjugated
A02710-2-Fluoro647 100 µg/Vial

Anti-INF2 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Myoglobin (A-6) PE
sc-393020 PE 200 µg/mL

Myoglobin (A-6) PE

Sign In for Pricing
View Details
GOLGA8B CRISPR Activation Plasmid (h)
sc-417013-ACT 20 µg

GOLGA8B CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Lentiviral human PYCR1 sgRNA gene knockout kit - Lentiviral human PYCR1 sgRNA gene knockout kit (25)
GTR15379782 1 Vial

Lentiviral human PYCR1 sgRNA gene knockout kit - Lentiviral human PYCR1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
MegaCD® CHO Ultra-concentrated Supplements
CSC-M0003 1 Each

MegaCD® CHO Ultra-concentrated Supplements

Sign In for Pricing
View Details
P53; Clone DO-7 (Ready-To-Use)
A00021-0007 7 mL

P53; Clone DO-7 (Ready-To-Use)

Sign In for Pricing
View Details