Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A6, Mouse

The S100A6 protein binds calcium and zinc ions and acts as a multifunctional regulator. Its presence in the extracellular matrix suggests its involvement in extracellular processes. S100A6 Protein, Mouse is the recombinant mouse-derived S100A6 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

S100A6 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a6-protein-mouse.html

Purity

95.00

Smiles

MACPLDQAIGLLVAIFHKYSGKEGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMDDLDRNKDQEVNFQEYVAFLGALALIYNEALK

Molecular Formula

20200 (Gene_ID) NP_035443.1 (M1-K89) (Accession)

Molecular Weight

Approximately 10 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNAQ Antibody (N-term)
MBS9205969-01 0.08 mL

GNAQ Antibody (N-term)

Sign In for Pricing
View Details
GNAQ Antibody (N-term)
MBS9205969-02 0.4 mL

GNAQ Antibody (N-term)

Sign In for Pricing
View Details
GNAQ Antibody (N-term)
MBS9205969-03 5x 0.4 mL

GNAQ Antibody (N-term)

Sign In for Pricing
View Details
Cellular Tumor Antigen p53 (TP53) Antibody
abx403197-01 100 µL

Cellular Tumor Antigen p53 (TP53) Antibody

Sign In for Pricing
View Details
Cellular Tumor Antigen p53 (TP53) Antibody
abx403197-02 200 µL

Cellular Tumor Antigen p53 (TP53) Antibody

Sign In for Pricing
View Details
Cellular Tumor Antigen p53 (TP53) Antibody
abx403197-03 1 mL

Cellular Tumor Antigen p53 (TP53) Antibody

Sign In for Pricing
View Details