Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A6, Mouse

The S100A6 protein binds calcium and zinc ions and acts as a multifunctional regulator. Its presence in the extracellular matrix suggests its involvement in extracellular processes. S100A6 Protein, Mouse is the recombinant mouse-derived S100A6 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

S100A6 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a6-protein-mouse.html

Purity

95.00

Smiles

MACPLDQAIGLLVAIFHKYSGKEGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMDDLDRNKDQEVNFQEYVAFLGALALIYNEALK

Molecular Formula

20200 (Gene_ID) NP_035443.1 (M1-K89) (Accession)

Molecular Weight

Approximately 10 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBPMS Recombinant Protein (Mouse)
RP167333 100 µg

RBPMS Recombinant Protein (Mouse)

Sign In for Pricing
View Details
SAFB Rabbit Polyclonal Antibody
orb511448 100 µg

SAFB Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DNALI1 Polyclonal Conjugated Antibody
C30532 100 µL

DNALI1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
CASP7 Antibody
orb2309487-01 20 µg

CASP7 Antibody

Sign In for Pricing
View Details
CASP7 Antibody
orb2309487-02 100 µg

CASP7 Antibody

Sign In for Pricing
View Details
CASP7 Antibody
orb2309487-03 100 ug (without BSA and Azide)

CASP7 Antibody

Sign In for Pricing
View Details