S100A6, Mouse
The S100A6 protein binds calcium and zinc ions and acts as a multifunctional regulator. Its presence in the extracellular matrix suggests its involvement in extracellular processes. S100A6 Protein, Mouse is the recombinant mouse-derived S100A6 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
S100A6 Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/s100a6-protein-mouse.html
Purity
95.00
Smiles
MACPLDQAIGLLVAIFHKYSGKEGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMDDLDRNKDQEVNFQEYVAFLGALALIYNEALK
Molecular Formula
20200 (Gene_ID) NP_035443.1 (M1-K89) (Accession)
Molecular Weight
Approximately 10 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7190309 Inquire
Rabbit anti-Caenorhabditis elegans rpa-1 Polyclonal Antibody
Sign In for Pricing
View Details 
orb3010909-01 20 µg
Recombinant Human Endogenous retrovirus group K member 19 Gag polyprotein (GAK19)
Sign In for Pricing
View Details orb3010909-02 100 µg
Recombinant Human Endogenous retrovirus group K member 19 Gag polyprotein (GAK19)
Sign In for Pricing
View Details