Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUTPase/DUT, Human

Deoxyuridine 5'-triphosphate nucleotidohydrolase (DUT) is an essential enzyme of nucleotide metabolism, as DUT hydrolyzes dUTP to dUMP and pyrophosphate, preventing uracil misincorporation into DNA efficiently and provides dUMP for thymidylate biosynthesis. DUT also prevents dimerization of PPAR and retinoid X receptor and is essential for embryonic development as well. dUTPase/DUT Protein, Human is the recombinant human-derived dUTPase/DUT protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

DUTPase/DUT Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dutpase-dut-protein-human.html

Purity

95.00

Smiles

MPCSEETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN

Molecular Formula

1854 (Gene_ID) P33316-2 (M1-N164) (Accession)

Molecular Weight

Approximately 18.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Donkey IgG Fractionated Purified Lyophilized
MBS136398-01 1 g

Donkey IgG Fractionated Purified Lyophilized

Sign In for Pricing
View Details
Donkey IgG Fractionated Purified Lyophilized
MBS136398-02 5x 1 g

Donkey IgG Fractionated Purified Lyophilized

Sign In for Pricing
View Details
PIK3R5 (NM_014308) Human Tagged ORF Clone
RG222249 10 µg

PIK3R5 (NM_014308) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Mouse Resistin/Retn Protein, His Tag
E40MOP2257 20 µg

Recombinant Mouse Resistin/Retn Protein, His Tag

Sign In for Pricing
View Details
MASP2 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-1980R-BF555-TR 20 µL

MASP2 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Phospho-GCN2 (Thr667) Polyclonal Antibody, RBITC Conjugated
bs-3156R-RBITC 100 µL

Phospho-GCN2 (Thr667) Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details