Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Protein E7, HPV (N-His, C-His)

Product Specifications

UNSPSC Description

HPV protein E7 can induce dormant cells to enter the cell cycle and promote the efficient use of cellular DNA replication mechanisms for viral genome replication. Through translational and transactivation activities, E7 disrupts the RB1-E2F1 complex and activates E2F1-regulated S-phase genes. Protein E7, HPV (N-His, C-His) is the recombinant Virus-derived protein E7, HPV, expressed by E. coli , with N-6*His, C-6*His labeled tag. The total length of Protein E7, HPV (N-His, C-His) is 98 a.a., with molecular weight of 16.3 kDa.

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/protein-e7-hpv-n-his-c-his.html

Smiles

MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP

Molecular Weight

16.3 kDa

Shipping Conditions

Room temperature

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-p53 (S33) Recombinant Rabbit Monoclonal Antibody [JE41-97]
HA722703 100 µL

Phospho-p53 (S33) Recombinant Rabbit Monoclonal Antibody [JE41-97]

Sign In for Pricing
View Details
3-Hydroxybutanoic Acid + 3-(3-Hydroxybutyryloxy)butyric Acid (CAS:7565-79-9) (50:50 Mixture)
TRC-B443823-10G 10 g

3-Hydroxybutanoic Acid + 3-(3-Hydroxybutyryloxy)butyric Acid (CAS:7565-79-9) (50:50 Mixture)

Sign In for Pricing
View Details
Filamin A (FLNA) Rabbit Polyclonal Antibody
TA376277 100 µL

Filamin A (FLNA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Trilaurin
TRC-T795420-500MG 500 mg

Trilaurin

Sign In for Pricing
View Details
(R)-beta-Butyrolactone
TRC-B761690-250MG 250 mg

(R)-beta-Butyrolactone

Sign In for Pricing
View Details
CD79a (IGA/764), CF594 conjugate, 0.1mg/mL
BNC940764-500 1x 500 µL

CD79a (IGA/764), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details