Protein E7, HPV (N-His, C-His)
Product Specifications
UNSPSC Description
HPV protein E7 can induce dormant cells to enter the cell cycle and promote the efficient use of cellular DNA replication mechanisms for viral genome replication. Through translational and transactivation activities, E7 disrupts the RB1-E2F1 complex and activates E2F1-regulated S-phase genes. Protein E7, HPV (N-His, C-His) is the recombinant Virus-derived protein E7, HPV, expressed by E. coli , with N-6*His, C-6*His labeled tag. The total length of Protein E7, HPV (N-His, C-His) is 98 a.a., with molecular weight of 16.3 kDa.
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/protein-e7-hpv-n-his-c-his.html
Smiles
MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP
Molecular Weight
16.3 kDa
Shipping Conditions
Room temperature
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog