Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Protein E7, HPV (N-His, C-His)

Product Specifications

UNSPSC Description

HPV protein E7 can induce dormant cells to enter the cell cycle and promote the efficient use of cellular DNA replication mechanisms for viral genome replication. Through translational and transactivation activities, E7 disrupts the RB1-E2F1 complex and activates E2F1-regulated S-phase genes. Protein E7, HPV (N-His, C-His) is the recombinant Virus-derived protein E7, HPV, expressed by E. coli , with N-6*His, C-6*His labeled tag. The total length of Protein E7, HPV (N-His, C-His) is 98 a.a., with molecular weight of 16.3 kDa.

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/protein-e7-hpv-n-his-c-his.html

Smiles

MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP

Molecular Weight

16.3 kDa

Shipping Conditions

Room temperature

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Integrin beta 1 (ITGB1) (NM_002211) Human Over-expression Lysate
LY400805 100 µg

Integrin beta 1 (ITGB1) (NM_002211) Human Over-expression Lysate

Sign In for Pricing
View Details
LDHB Mouse Monoclonal Antibody [Clone ID: AT14D7]
AM50625PU-S 50 µL

LDHB Mouse Monoclonal Antibody [Clone ID: AT14D7]

Sign In for Pricing
View Details
Ebastine N-Oxide
TRC-E320015-100MG 100 mg

Ebastine N-Oxide

Sign In for Pricing
View Details
Cytokeratin 8/18 (KRT8/803 + KRT18/835), 0.2mg/mL
BNUB0979-100 1x 100 µL

Cytokeratin 8/18 (KRT8/803 + KRT18/835), 0.2mg/mL

Sign In for Pricing
View Details
2’-Nitrophenyl 2,3,4-Tri-O-acetyl-Beta-D-xylopyranoside
TRC-N506985-10MG 10 mg

2’-Nitrophenyl 2,3,4-Tri-O-acetyl-Beta-D-xylopyranoside

Sign In for Pricing
View Details
TentaGel® R OH
R28900.5G 5 g

TentaGel® R OH

Sign In for Pricing
View Details