CCND2, Human (His)
CCND2 Protein, Human (His) is a D-type cyclin with key roles in cell cycle regulation, differentiation, and malignant transformation.
Product Specifications
Product Name Alternative
CCND2 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ccnd2-protein-human-his.html
Smiles
HHHHHHMELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL
Molecular Formula
894 (Gene_ID) P30279 (M1-L289) (Accession)
Molecular Weight
Approximately 35 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Di Wang, et al. CCND2 mRNA Expression Is Correlated With R-CHOP Treatment Efficacy and Prognosis in Patients With ABC-DLBCL. Front Oncol. 2020 Jul 21;10:1180.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15277244 1 Vial
Lentiviral mouse Ddias shRNA (UAS) - Lentiviral mouseDdias shRNA (UAS, GFP) (25)
Sign In for Pricing
View Details 