Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCND2, Human (His)

CCND2 Protein, Human (His) is a D-type cyclin with key roles in cell cycle regulation, differentiation, and malignant transformation.

Product Specifications

Product Name Alternative

CCND2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccnd2-protein-human-his.html

Smiles

HHHHHHMELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL

Molecular Formula

894 (Gene_ID) P30279 (M1-L289) (Accession)

Molecular Weight

Approximately 35 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Di Wang, et al. CCND2 mRNA Expression Is Correlated With R-CHOP Treatment Efficacy and Prognosis in Patients With ABC-DLBCL. Front Oncol. 2020 Jul 21;10:1180.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

APC-Linked Polyclonal Antibody to Myosin Light Chain Kinase (MYLK)
MBS2051644-01 0.1 mL

APC-Linked Polyclonal Antibody to Myosin Light Chain Kinase (MYLK)

Ask
View Details
APC-Linked Polyclonal Antibody to Myosin Light Chain Kinase (MYLK)
MBS2051644-02 0.2 mL

APC-Linked Polyclonal Antibody to Myosin Light Chain Kinase (MYLK)

Ask
View Details
APC-Linked Polyclonal Antibody to Myosin Light Chain Kinase (MYLK)
MBS2051644-03 0.5 mL

APC-Linked Polyclonal Antibody to Myosin Light Chain Kinase (MYLK)

Ask
View Details
APC-Linked Polyclonal Antibody to Myosin Light Chain Kinase (MYLK)
MBS2051644-04 1 mL

APC-Linked Polyclonal Antibody to Myosin Light Chain Kinase (MYLK)

Ask
View Details
APC-Linked Polyclonal Antibody to Myosin Light Chain Kinase (MYLK)
MBS2051644-05 5 mL

APC-Linked Polyclonal Antibody to Myosin Light Chain Kinase (MYLK)

Ask
View Details
APC-Linked Polyclonal Antibody to Myosin Light Chain Kinase (MYLK)
MBS2051644-06 5x 5 mL

APC-Linked Polyclonal Antibody to Myosin Light Chain Kinase (MYLK)

Ask
View Details