Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALK-7, Human (HEK293, Fc)

Selected Variant

HY-P74417-01

Size: 2 µg

ALK-7 is a type I receptor serine-threonine kinase mediate inhibitory as well as stimulatory signals for growth and differentiation by binding to members of the TGF-β superfamily. ALK-7 combined with specific ligands, such as Nodal, activin B and growth differentiation factor (GDF), can activate Smads and other signaling pathways, thereby regulating cell proliferation, differentiation and apoptosis in various cells[1][2][3]. ALK-7 Protein, Human (HEK293, Fc) is produced in HEK293 cells with a C-Terminal Fc-tag. It consists of 113 amino acids (M1-E113) .

Product Specifications

Product Name Alternative

ALK-7 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/alk-7-protein-human-hek293-fc.html

Purity

97.00

Smiles

LSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPME

Molecular Formula

130399 (Gene_ID) Q8NER5 (L22-E113) (Accession)

Molecular Weight

The recombinant human ALK-7 consists of 92 amino acids & hFc tag and predicts a molecular mass of 35.96 kDa. It migrates as an approximately 43-56 kDa band in SDS-PAGE under reducing conditions.

References & Citations

[1]M Rydén, et al. A novel type I receptor serine-threonine kinase predominantly expressed in the adult central nervous system. J Biol Chem. 1996 Nov 29;271 (48) :30603-9.|[2]Byung-Chul Kim, et al. Activin receptor-like kinase-7 induces apoptosis through activation of MAPKs in a Smad3-dependent mechanism in hepatoma cells. J Biol Chem. 2004 Jul 2;279 (27) :28458-65.|[3]Wen-bo Li, et al. Silencing of activin receptor-like kinase 7 alleviates aortic stiffness in type 2 diabetic rats. Acta Diabetol. 2015 Aug;52 (4) :717-26.|[4]Kunihiro Tsuchida, et al. Activin isoforms signal through type I receptor serine/threonine kinase ALK7. Mol Cell Endocrinol. 2004 May 31;220 (1-2) :59-65.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Price

Sign In for Pricing

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD34 (HPCA1/763), CF740 conjugate, 0.1mg/mL
BNC740763-100 1x 100 µL

CD34 (HPCA1/763), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DDR2 Mouse Monoclonal Antibody [A9H5]
HA601150 100 µL

DDR2 Mouse Monoclonal Antibody [A9H5]

Sign In for Pricing
View Details
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2618), CF568 conjugate, 0.1mg/mL
BNC682618-500 1x 500 µL

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2618), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Anti-DNA polymerase eta/POLH Antibody Picoband® (Cy3 Conjugate)
PB9813-Cy3 100 µg/Vial

Anti-DNA polymerase eta/POLH Antibody Picoband® (Cy3 Conjugate)

Sign In for Pricing
View Details
HRP Conjugated beta Tubulin Recombinant Rabbit Monoclonal Antibody [JF41-50]
ET1702-68 100 µL

HRP Conjugated beta Tubulin Recombinant Rabbit Monoclonal Antibody [JF41-50]

Sign In for Pricing
View Details
Smooth Muscle Myosin Heavy Chain (SM-MHC) (MYH11/2303R), 0.2mg/mL
BNUB2303-100 1x 100 µL

Smooth Muscle Myosin Heavy Chain (SM-MHC) (MYH11/2303R), 0.2mg/mL

Sign In for Pricing
View Details