Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-2, Mouse (His)

FGF-2 is a member of the fibroblast family involved in bone healing, cartilage repair, bone repair, and nerve regeneration. FGF-2 is also a mitotic promoter that accelerates cell proliferation. FGF-2 regulates immune processes by specifically targeting tyrosine kinase receptors and activating the FGF/FGFR signaling pathway. For example, FGF-2 is involved in the JAK-STAT signaling pathway to regulate cartilage metabolism and also activates ERK signaling to promote cartilage regeneration. FGF-2 combined with FGFR1/3 promoted degeneration and repair of articular cartilage, respectively[1]. FGF-2 is also a known carcinogen in GBM, which contributes to glioma growth and vascularization[2].FGF-2 Protein, Mouse (His), consists of 144 amino acids, produced by E.coli with N-His.

Product Specifications

Product Name Alternative

FGF-2 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-2-protein-mouse-his.html

Purity

97.00

Smiles

ALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Molecular Formula

14173 (Gene_ID) NP_032032.1 (A11-S154) (Accession)

Molecular Weight

Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Zhang J, et al. FGF2: a key regulator augmenting tendon-to-bone healing and cartilage repair. Regen Med. 2020 Sep;15 (9) :2129-2142.|[2]Jimenez-Pascual A, et al. FGF2: a novel druggable target for glioblastoma? Expert Opin Ther Targets. 2020 Apr;24 (4) :311-318.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TTYH2 (NM_032646) Human Tagged ORF Clone Lentiviral Particle
RC214909L3V 200 µL

TTYH2 (NM_032646) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
Zfp784 ORF Vector (Mouse) (pORF)
51130014 1.0 µg DNA

Zfp784 ORF Vector (Mouse) (pORF)

Ask
View Details
MAP3K12 Human Pre-designed siRNA Set A
HY-RS08049 1 Set

MAP3K12 Human Pre-designed siRNA Set A

Ask
View Details
Anti-FBN1/Fibrillin-1 Polyclonal Antibody
PHE12501 100 μg

Anti-FBN1/Fibrillin-1 Polyclonal Antibody

Ask
View Details
Immortalized Duck Fibroblast Cell Line (DEF)
T0476 1x106 cells / 1.0 mL

Immortalized Duck Fibroblast Cell Line (DEF)

Ask
View Details