Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-2, Mouse (His)

FGF-2 is a member of the fibroblast family involved in bone healing, cartilage repair, bone repair, and nerve regeneration. FGF-2 is also a mitotic promoter that accelerates cell proliferation. FGF-2 regulates immune processes by specifically targeting tyrosine kinase receptors and activating the FGF/FGFR signaling pathway. For example, FGF-2 is involved in the JAK-STAT signaling pathway to regulate cartilage metabolism and also activates ERK signaling to promote cartilage regeneration. FGF-2 combined with FGFR1/3 promoted degeneration and repair of articular cartilage, respectively[1]. FGF-2 is also a known carcinogen in GBM, which contributes to glioma growth and vascularization[2].FGF-2 Protein, Mouse (His), consists of 144 amino acids, produced by E.coli with N-His.

Product Specifications

Product Name Alternative

FGF-2 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-2-protein-mouse-his.html

Purity

97.00

Smiles

ALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Molecular Formula

14173 (Gene_ID) NP_032032.1 (A11-S154) (Accession)

Molecular Weight

Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Zhang J, et al. FGF2: a key regulator augmenting tendon-to-bone healing and cartilage repair. Regen Med. 2020 Sep;15 (9) :2129-2142.|[2]Jimenez-Pascual A, et al. FGF2: a novel druggable target for glioblastoma? Expert Opin Ther Targets. 2020 Apr;24 (4) :311-318.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Frozen Tissue Sections, Kidney
CS625338 5x 5 µm

Frozen Tissue Sections, Kidney

Ask
View Details
LMO2 Human shRNA Plasmid Kit (Locus ID 4005)
TR311707 1 Kit

LMO2 Human shRNA Plasmid Kit (Locus ID 4005)

Ask
View Details
Luteinizing Hormone Beta Polypeptide (LHB) Antibody
abx002179-01 20 µL

Luteinizing Hormone Beta Polypeptide (LHB) Antibody

Ask
View Details
Luteinizing Hormone Beta Polypeptide (LHB) Antibody
abx002179-02 100 µL

Luteinizing Hormone Beta Polypeptide (LHB) Antibody

Ask
View Details
Luteinizing Hormone Beta Polypeptide (LHB) Antibody
abx002179-03 2x 100 µL

Luteinizing Hormone Beta Polypeptide (LHB) Antibody

Ask
View Details
1,3-Diiminoisoindoline
TRC-D455198-500MG 500 mg

1,3-Diiminoisoindoline

Ask
View Details