Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vibrio parahaemolyticus serotype O3:K6 Thermostable direct hemolysin 1 (tdh1)

Product Specifications

Product Name Alternative

(Kanagawa phenomenon-associated hemolysin)

Abbreviation

Recombinant Vibrio parahaemolyticus serotype O3:K6 tdh1 protein

Gene Name

Tdh1

UniProt

P19249

Expression Region

25-189aa

Organism

Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

Target Sequence

FELPSVPFPAPGSDEILFVVRDTTFNTQAPVNVKVSDFWTNRNVKRKPYEDVYGQSVFTTSGTKWLTSYMTVNINDKDYTMAAVSGYKSGHSAVFVKSGQVQLQHSYNSVANFVGEDEGSIPSKMYLDETPEYFVNVEAYESGSGNILVMCISNKESFFECKHQQ

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Bacterial hemolysins are exotoxins that attack blood cell membranes and cause cell rupture by mechanisms not clearly defined.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.0 kDa

References & Citations

"Genome sequence of Vibrio parahaemolyticus: a pathogenic mechanism distinct from that of V. cholerae." Makino K., Oshima K., Kurokawa K., Yokoyama K., Uda T., Tagomori K., Iijima Y., Najima M., Nakano M., Yamashita A., Kubota Y., Kimura S., Yasunaga T., Honda T., Shinagawa H., Hattori M., Iida T. Lancet 361:743-749 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human polymeric immunoglobulin receptor-secretory component, PIGR-SC ELISA KIT
E0320Hu-01 48 Well

Human polymeric immunoglobulin receptor-secretory component, PIGR-SC ELISA KIT

Sign In for Pricing
View Details
Human polymeric immunoglobulin receptor-secretory component, PIGR-SC ELISA KIT
E0320Hu-02 96 Well

Human polymeric immunoglobulin receptor-secretory component, PIGR-SC ELISA KIT

Sign In for Pricing
View Details
Human polymeric immunoglobulin receptor-secretory component, PIGR-SC ELISA KIT
E0320Hu-03 5x 96 Tests

Human polymeric immunoglobulin receptor-secretory component, PIGR-SC ELISA KIT

Sign In for Pricing
View Details
Human polymeric immunoglobulin receptor-secretory component, PIGR-SC ELISA KIT
E0320Hu-04 10x 96 Tests

Human polymeric immunoglobulin receptor-secretory component, PIGR-SC ELISA KIT

Sign In for Pricing
View Details
Proteasome 20S alpha 2/HC3 Antibody (YA2384, Rabbit)
HY-P82639-01 10 µL

Proteasome 20S alpha 2/HC3 Antibody (YA2384, Rabbit)

Sign In for Pricing
View Details
Proteasome 20S alpha 2/HC3 Antibody (YA2384, Rabbit)
HY-P82639-02 50 μL

Proteasome 20S alpha 2/HC3 Antibody (YA2384, Rabbit)

Sign In for Pricing
View Details