Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCL17, Human

The CXCL17 protein is a chemokine that attracts monocytes, macrophages, and dendritic cells and plays a role in angiogenesis and potential tumor development. CXCL17 Protein, Human is the recombinant human-derived CXCL17 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

CXCL17 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Purity

96.45

Smiles

SSLNPGVARGHRDRGQASRRWLQEGGQECECKDWFLRAPRRKFMTVSGLPKKQCPCDHFKGNVKKTRHQRHHRKPNKHSRACQQFLKQCQLRSFALPL

Molecular Formula

284340 (Gene_ID) Q6UXB2 (S22-L119) (Accession)

Molecular Weight

Approximately 12 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SFRS2B Antibody Blocking Peptide
orb1507069 500 µg

SFRS2B Antibody Blocking Peptide

Sign In for Pricing
View Details
RNF34 HDR Plasmid (h)
sc-413358-HDR 20 µg

RNF34 HDR Plasmid (h)

Sign In for Pricing
View Details
PEPD Adenovirus (Human)
36389051 1.0 mL

PEPD Adenovirus (Human)

Sign In for Pricing
View Details
TIMP4 (TIMP-4, Tissue Inhibitor of Metalloproteinases 4) (MaxLight 650)
MBS6449888-01 0.1 mL

TIMP4 (TIMP-4, Tissue Inhibitor of Metalloproteinases 4) (MaxLight 650)

Sign In for Pricing
View Details
TIMP4 (TIMP-4, Tissue Inhibitor of Metalloproteinases 4) (MaxLight 650)
MBS6449888-02 5x 0.1 mL

TIMP4 (TIMP-4, Tissue Inhibitor of Metalloproteinases 4) (MaxLight 650)

Sign In for Pricing
View Details
Scotts Tap Water Substitute (10 x Concentrate)
RRSP190-F 2.5 L

Scotts Tap Water Substitute (10 x Concentrate)

Sign In for Pricing
View Details