Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANO1/Anoctamin-1, Human (N-His, C-Myc)

ANO1/Anoctamin-1 protein, a calcium-activated chloride channel (CaCC), is involved in ion transport, smooth muscle contraction, and mucus secretion. ANO1/Anoctamin-1 Protein, Human (N-His, C-Myc) is the recombinant human-derived ANO1/Anoctamin-1 protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.

Product Specifications

Product Name Alternative

ANO1/Anoctamin-1 Protein, Human (N-His, C-Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ano1-anoctamin-1-protein-human-n-his-c-myc.html

Purity

95.0

Smiles

SFTSDFIPRLVYLYMYSKNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKYDISKDFWAVLAARLA

Molecular Formula

55107 (Gene_ID) Q5XXA6-1 (S806-A892) (Accession)

Molecular Weight

Approximately 17.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta-tubulin Monoclonal Antibody (M7)
BT-MCA1357-01 20 µL

Beta-tubulin Monoclonal Antibody (M7)

Sign In for Pricing
View Details
Beta-tubulin Monoclonal Antibody (M7)
BT-MCA1357-02 50 µL

Beta-tubulin Monoclonal Antibody (M7)

Sign In for Pricing
View Details
Beta-tubulin Monoclonal Antibody (M7)
BT-MCA1357-03 100 µL

Beta-tubulin Monoclonal Antibody (M7)

Sign In for Pricing
View Details
Chicken PKCe ELISA Kit
ECKP0109 96 Tests

Chicken PKCe ELISA Kit

Sign In for Pricing
View Details
ZNF208 Human shRNA Lentiviral Particle (Locus ID 7757)
TL315628V 500 µL Each

ZNF208 Human shRNA Lentiviral Particle (Locus ID 7757)

Sign In for Pricing
View Details
H2AFJ sgRNA CRISPR Lentivector (Human) (Target 2)
K0925003 1.0 µg DNA

H2AFJ sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details