Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P-selectin, Human (HEK293, His)

P-selectin is a Ca (2+) -dependent receptor on myeloid cells that critically binds to sialic acid-Lewis X on neutrophils and monocytes, promoting the interaction between activated endothelial cells or platelets and leukocytes interaction. This binding primarily to SELPLG/PSGL1 and PODXL2 is critical for rapid rolling of leukocytes during early inflammation. P-selectin Protein, Human (HEK293, His) is the recombinant human-derived P-selectin protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

P-selectin Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/p-selectin-protein-human-hek-293-his.html

Purity

98.00

Smiles

WTYHYSTKAYSWNISRKYCQNRYTDLVAIQNKNEIDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTKKALTNEAENWADNEPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVRECGELELPQHVLMNCSHPLGNFSFNSQCSFHCTDGYQVNGPSKLECLASGIWTNKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCSFSCEEGFALVGPEVVQCTASGVWTAPAPVCKAVQCQHLEAPSEGTMDCVHPLTAFAYGSSCKFECQPGYRVRGLDMLRCIDSGHWSAPLPTCEAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGFMLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCSFTCNEGLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCQFICDEGYSLSGPERLDCTRSGRWTDSPPMCEAIKCPELFAPEQGSLDCSDTRGEFNVGSTCHFSCDNGFKLEGPNNVECTTSGRWSATPPTCKGIASLPTPGLQCPALTTPGQGTMYCRHHPGTFGFNTTCYFGCNAGFTLIGDSTLSCRPSGQWTAVTPACRAVKCSELHVNKPIAMNCSNLWGNFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQEA

Molecular Formula

6403 (Gene_ID) P16109 (W42-A771) (Accession)

Molecular Weight

Approximately 95-130 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GPA33 Protein, His Tag
E40KMPH6132 20 µg

Human GPA33 Protein, His Tag

Sign In for Pricing
View Details
AMY2A Polyclonal Antibody, RBITC Conjugated
bs-3975R-RBITC 100 µL

AMY2A Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Net1 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7322003 1.0 µg DNA

Net1 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
ALCAM (CD166 Antigen, Activated Leukocyte Cell Adhesion M) olecule
475055 100 µL

ALCAM (CD166 Antigen, Activated Leukocyte Cell Adhesion M) olecule

Sign In for Pricing
View Details
Milk Beta-Lactoglobulin Polyclonal Antibody, HRP Conjugated
A57782-050 50 µL

Milk Beta-Lactoglobulin Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
LACTB Double Nickase Plasmid (m)
sc-429847-NIC 20 µg

LACTB Double Nickase Plasmid (m)

Sign In for Pricing
View Details