Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF70, Human (His)

The ZNF70 protein itself is a potential regulator of transcriptional processes, suggesting that it may play a role in shaping cellular function through gene expression control. Although the specific mechanisms and target genes affected by ZNF70 are not fully understood, its versatility in transcriptional regulation implies potential effects on a variety of cellular pathways. ZNF70 Protein, Human (His) is the recombinant human-derived ZNF70 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ZNF70 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/znf70-protein-human-his.html

Smiles

MEVPPATKFGETFAFENRLESQQGLFPGEDLGDPFLQERGLEQMAVIYKEIPLGEQDEENDDYEGNFSLCSSPVQHQSIPPGTRPQDDELFGQTFLQKSDLSMCQIIHSEEPSPCDCAETDRGDSGPNAPHRTPQPAKPYACRECGKAFSQSSHLLRHLVIHTGEKPYECCECGKAFSQSSHLLRHQIIHTGEKPYECRECGKAFRQSSALTQHQKIHTGKRPYECRECGKDFSRSSSLRKHERIHTGERPYQCKECGKSFNQSSGLSQHRKIHTLKKPHECDLCGKAFCHRSHLIRHQRIHTGKKPYKCDECGKAFSQSSNLIEHRKTHTGEKPYKCQKCGKAFSQSSSLIEHQRIHTGEKPYECCQCGKAFCHSSALIQHQRIHTGKKPYTCECGKAFRHRSALIEHYKTHTREKPYVCNLCGKSFRGSSHLIRHQKIHSGEKL

Molecular Formula

7621 (Gene_ID) Q9UC06 (M1-L446) (Accession)

Molecular Weight

Approximately 60 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human LGALS9B Protein, N-His
YHH59901 100 μg

Recombinant Human LGALS9B Protein, N-His

Ask
View Details
BMP4 (Bone Morphogenetic Protein 4, BMP2B, BMP2-B, BMP2B1, ZYME, DVR4, Bone Morphogenetic Protein 2B)
362300 200 µL

BMP4 (Bone Morphogenetic Protein 4, BMP2B, BMP2-B, BMP2B1, ZYME, DVR4, Bone Morphogenetic Protein 2B)

Ask
View Details
Recombinant Human NRN1 Protein (His Tag)
E53A06593 50 µg

Recombinant Human NRN1 Protein (His Tag)

Ask
View Details
Human TBRG1 (NM_032811) AAV Particle
RC229201A1V 250 µL

Human TBRG1 (NM_032811) AAV Particle

Ask
View Details
Mouse Beta/gamma crystallin domain-containing protein 3 (CRYBG3) ELISA Kit
MBS7216656-01 48 Well

Mouse Beta/gamma crystallin domain-containing protein 3 (CRYBG3) ELISA Kit

Ask
View Details
Mouse Beta/gamma crystallin domain-containing protein 3 (CRYBG3) ELISA Kit
MBS7216656-02 96 Well

Mouse Beta/gamma crystallin domain-containing protein 3 (CRYBG3) ELISA Kit

Ask
View Details