Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF70, Human (His)

The ZNF70 protein itself is a potential regulator of transcriptional processes, suggesting that it may play a role in shaping cellular function through gene expression control. Although the specific mechanisms and target genes affected by ZNF70 are not fully understood, its versatility in transcriptional regulation implies potential effects on a variety of cellular pathways. ZNF70 Protein, Human (His) is the recombinant human-derived ZNF70 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ZNF70 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/znf70-protein-human-his.html

Smiles

MEVPPATKFGETFAFENRLESQQGLFPGEDLGDPFLQERGLEQMAVIYKEIPLGEQDEENDDYEGNFSLCSSPVQHQSIPPGTRPQDDELFGQTFLQKSDLSMCQIIHSEEPSPCDCAETDRGDSGPNAPHRTPQPAKPYACRECGKAFSQSSHLLRHLVIHTGEKPYECCECGKAFSQSSHLLRHQIIHTGEKPYECRECGKAFRQSSALTQHQKIHTGKRPYECRECGKDFSRSSSLRKHERIHTGERPYQCKECGKSFNQSSGLSQHRKIHTLKKPHECDLCGKAFCHRSHLIRHQRIHTGKKPYKCDECGKAFSQSSNLIEHRKTHTGEKPYKCQKCGKAFSQSSSLIEHQRIHTGEKPYECCQCGKAFCHSSALIQHQRIHTGKKPYTCECGKAFRHRSALIEHYKTHTREKPYVCNLCGKSFRGSSHLIRHQKIHSGEKL

Molecular Formula

7621 (Gene_ID) Q9UC06 (M1-L446) (Accession)

Molecular Weight

Approximately 60 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZDHHC16 Antibody
A64252-100UL 100 µL

ZDHHC16 Antibody

Sign In for Pricing
View Details
RANK Polyclonal Antibody, PE Conjugated
bs-42227R-PE 100 µL

RANK Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Comb (18/10 teeth)
TT-HES-1-CB 1 Unit

Comb (18/10 teeth)

Sign In for Pricing
View Details
APH1A sgRNA CRISPR Lentivector (Human) (Target 2)
K0103603 1.0 µg DNA

APH1A sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Lentiviral human GSTCD shRNA (UAS) - Lentiviral human GSTCD shRNA (UAS, iRFP) (25)
GTR15123566 1 Vial

Lentiviral human GSTCD shRNA (UAS) - Lentiviral human GSTCD shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
M/PIC1200/NL354/TM-210X297-1 Personal Protection (PPE) Signs & Labels (Adhesive)
199302 1 Pack (1 Panel (s) x 1 Pack)

M/PIC1200/NL354/TM-210X297-1 Personal Protection (PPE) Signs & Labels (Adhesive)

Sign In for Pricing
View Details