Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF70, Human (His)

The ZNF70 protein itself is a potential regulator of transcriptional processes, suggesting that it may play a role in shaping cellular function through gene expression control. Although the specific mechanisms and target genes affected by ZNF70 are not fully understood, its versatility in transcriptional regulation implies potential effects on a variety of cellular pathways. ZNF70 Protein, Human (His) is the recombinant human-derived ZNF70 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ZNF70 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/znf70-protein-human-his.html

Smiles

MEVPPATKFGETFAFENRLESQQGLFPGEDLGDPFLQERGLEQMAVIYKEIPLGEQDEENDDYEGNFSLCSSPVQHQSIPPGTRPQDDELFGQTFLQKSDLSMCQIIHSEEPSPCDCAETDRGDSGPNAPHRTPQPAKPYACRECGKAFSQSSHLLRHLVIHTGEKPYECCECGKAFSQSSHLLRHQIIHTGEKPYECRECGKAFRQSSALTQHQKIHTGKRPYECRECGKDFSRSSSLRKHERIHTGERPYQCKECGKSFNQSSGLSQHRKIHTLKKPHECDLCGKAFCHRSHLIRHQRIHTGKKPYKCDECGKAFSQSSNLIEHRKTHTGEKPYKCQKCGKAFSQSSSLIEHQRIHTGEKPYECCQCGKAFCHSSALIQHQRIHTGKKPYTCECGKAFRHRSALIEHYKTHTREKPYVCNLCGKSFRGSSHLIRHQKIHSGEKL

Molecular Formula

7621 (Gene_ID) Q9UC06 (M1-L446) (Accession)

Molecular Weight

Approximately 60 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Goat Desmin (Des) ELISA Kit
NSL0839Gt 96 Tests

Goat Desmin (Des) ELISA Kit

Ask
View Details
Silicon High Vacuum Grease
02311 00050 50 g

Silicon High Vacuum Grease

Ask
View Details
PLTP Protein (C-His, Human)
P517593 100 µg

PLTP Protein (C-His, Human)

Ask
View Details
BIOPHEN CS-11 (22) - Factor Xa
229015 25 mg

BIOPHEN CS-11 (22) - Factor Xa

Ask
View Details
TRAF3IP1, ID (TRAF3IP1, MIPT3, TRAF3-interacting protein 1, Interleukin-13 receptor alpha 1-binding protein 1, Microtubule-interacting protein associated with TRAF3) (AP)
MBS6357857-01 0.2 mL

TRAF3IP1, ID (TRAF3IP1, MIPT3, TRAF3-interacting protein 1, Interleukin-13 receptor alpha 1-binding protein 1, Microtubule-interacting protein associated with TRAF3) (AP)

Ask
View Details
TRAF3IP1, ID (TRAF3IP1, MIPT3, TRAF3-interacting protein 1, Interleukin-13 receptor alpha 1-binding protein 1, Microtubule-interacting protein associated with TRAF3) (AP)
MBS6357857-02 5x 0.2 mL

TRAF3IP1, ID (TRAF3IP1, MIPT3, TRAF3-interacting protein 1, Interleukin-13 receptor alpha 1-binding protein 1, Microtubule-interacting protein associated with TRAF3) (AP)

Ask
View Details