Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF70, Human (His)

The ZNF70 protein itself is a potential regulator of transcriptional processes, suggesting that it may play a role in shaping cellular function through gene expression control. Although the specific mechanisms and target genes affected by ZNF70 are not fully understood, its versatility in transcriptional regulation implies potential effects on a variety of cellular pathways. ZNF70 Protein, Human (His) is the recombinant human-derived ZNF70 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ZNF70 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/znf70-protein-human-his.html

Smiles

MEVPPATKFGETFAFENRLESQQGLFPGEDLGDPFLQERGLEQMAVIYKEIPLGEQDEENDDYEGNFSLCSSPVQHQSIPPGTRPQDDELFGQTFLQKSDLSMCQIIHSEEPSPCDCAETDRGDSGPNAPHRTPQPAKPYACRECGKAFSQSSHLLRHLVIHTGEKPYECCECGKAFSQSSHLLRHQIIHTGEKPYECRECGKAFRQSSALTQHQKIHTGKRPYECRECGKDFSRSSSLRKHERIHTGERPYQCKECGKSFNQSSGLSQHRKIHTLKKPHECDLCGKAFCHRSHLIRHQRIHTGKKPYKCDECGKAFSQSSNLIEHRKTHTGEKPYKCQKCGKAFSQSSSLIEHQRIHTGEKPYECCQCGKAFCHSSALIQHQRIHTGKKPYTCECGKAFRHRSALIEHYKTHTREKPYVCNLCGKSFRGSSHLIRHQKIHSGEKL

Molecular Formula

7621 (Gene_ID) Q9UC06 (M1-L446) (Accession)

Molecular Weight

Approximately 60 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-GSK3 beta (Ser9) Recombinant Rabbit mAb
ARM2960-01 30 µL

Phospho-GSK3 beta (Ser9) Recombinant Rabbit mAb

Sign In for Pricing
View Details
Phospho-GSK3 beta (Ser9) Recombinant Rabbit mAb
ARM2960-02 50 μL

Phospho-GSK3 beta (Ser9) Recombinant Rabbit mAb

Sign In for Pricing
View Details
Phospho-GSK3 beta (Ser9) Recombinant Rabbit mAb
ARM2960-03 100 µL

Phospho-GSK3 beta (Ser9) Recombinant Rabbit mAb

Sign In for Pricing
View Details
Glast
PA1038-S 100μg

Glast

Sign In for Pricing
View Details
EGR2 Recombinant Monoclonal Antibody [27C3]
A73749-100 100 µL

EGR2 Recombinant Monoclonal Antibody [27C3]

Sign In for Pricing
View Details
Monoclonal Antibody to Actin Alpha 2, Smooth Muscle (ACTa2)
MBS2126648-01 0.1 mL

Monoclonal Antibody to Actin Alpha 2, Smooth Muscle (ACTa2)

Sign In for Pricing
View Details