Animal-Free IL-32 alpha, Human (His)
IL-32 alpha Protein, a cytokine, potentially contributes to innate and adaptive immune responses. It induces TNFA/TNF-alpha and IL8, activating typical cytokine signal pathways, including NF-kappa-B and p38 MAPK. Animal-Free IL-32 alpha Protein, Human (His) is the recombinant human-derived animal-FreeIL-32 alpha protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free IL-32 alpha Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-il-32-alpha-protein-human-his.html
Purity
98.00
Smiles
MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKSYGAPRGDKEELTPQKCSEPQSSK
Molecular Formula
9235 (Gene_ID) P24001-4 (M1-K131) (Accession)
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Recombinant Xenopus laevis Peptidyl-prolyl cis-trans isomerase FKBP1A (fkbp1a)
Recombinant Xenopus laevis Peptidyl-prolyl cis-trans isomerase FKBP1A (fkbp1a)
Recombinant Xenopus laevis Peptidyl-prolyl cis-trans isomerase FKBP1A (fkbp1a)
Recombinant Xenopus laevis Peptidyl-prolyl cis-trans isomerase FKBP1A (fkbp1a)