Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Trefoil factor 3 (TFF3), partial

Product Specifications

Product Name Alternative

Intestinal trefoil factor (hITF) (Polypeptide P1.B) (hP1.B) (ITF) (TFI)

Abbreviation

Recombinant Human TFF3 protein, partial

Gene Name

TFF3

UniProt

Q07654

Expression Region

29-80aa

Organism

Homo sapiens (Human)

Target Sequence

ANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

33.2 kDa

References & Citations

"mRNA 5' region sequence incompleteness: a potential source of systematic errors in translation initiation codon assignment in human mRNAs." Casadei R., Strippoli P., D'Addabbo P., Canaider S., Lenzi L., Vitale L., Giannone S., Frabetti F., Facchin F., Carinci P., Zannotti M. Gene 321:185-193 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS646257 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
BAT3 (BAG6) (NM_001098534) Human Over-expression Lysate
LY420631 100 µg

BAT3 (BAG6) (NM_001098534) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse IL-7 Recombinant Rabbit monoclonal Antibody
HA723623B 100 µL

Mouse IL-7 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3257), CF568 conjugate, 0.1mg/mL
BNC683257-100 1x 100 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3257), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Imperialine
TRC-I492500-50MG 50 mg

Imperialine

Sign In for Pricing
View Details
NUDT2 (NM_001161) Human Over-expression Lysate
LC420095 20 µg

NUDT2 (NM_001161) Human Over-expression Lysate

Sign In for Pricing
View Details