Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Trefoil factor 3 (TFF3), partial

Product Specifications

Product Name Alternative

Intestinal trefoil factor (hITF) (Polypeptide P1.B) (hP1.B) (ITF) (TFI)

Abbreviation

Recombinant Human TFF3 protein, partial

Gene Name

TFF3

UniProt

Q07654

Expression Region

29-80aa

Organism

Homo sapiens (Human)

Target Sequence

ANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

33.2 kDa

References & Citations

"mRNA 5' region sequence incompleteness: a potential source of systematic errors in translation initiation codon assignment in human mRNAs." Casadei R., Strippoli P., D'Addabbo P., Canaider S., Lenzi L., Vitale L., Giannone S., Frabetti F., Facchin F., Carinci P., Zannotti M. Gene 321:185-193 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Exoc7 activation kit by CRISPRa
GA205568 1 Kit

Mouse Exoc7 activation kit by CRISPRa

Sign In for Pricing
View Details
CDK1 pTyr15 Rabbit Polyclonal Antibody
AP02497PU-S 50 µL

CDK1 pTyr15 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MCM7 (Proliferation Marker) (rMCM7/1468), CF640R conjugate, 0.1mg/mL
BNC403195-500 1x 500 µL

MCM7 (Proliferation Marker) (rMCM7/1468), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human SWI5 activation kit by CRISPRa
GA117833 1 Kit

Human SWI5 activation kit by CRISPRa

Sign In for Pricing
View Details
TRA2A antibody
FNab08913 100 µg

TRA2A antibody

Sign In for Pricing
View Details
MERSC-CoV Spike Protein Goat Polyclonal Antibody
AB0161-200 600 µg

MERSC-CoV Spike Protein Goat Polyclonal Antibody

Sign In for Pricing
View Details