Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse A disintegrin and metalloproteinase with thrombospondin motifs 13 (Adamts13), partial

Product Specifications

Product Name Alternative

Von Willebrand factor-cleaving protease (vWF-CP) (vWF-cleaving protease) (ADAM-TS 13) (ADAM-TS13) (ADAMTS-13) (Gm710)

Abbreviation

Recombinant Mouse Adamts13 protein, partial

Gene Name

Adamts13

UniProt

Q769J6

Expression Region

904-1137aa

Organism

Mus musculus (Mouse)

Target Sequence

WTPLVGLCSISCGRGLKELYFLCMDSVLKMPVQEELCGLASKPPSRWEVCRARPCPARWETQVLAPCPVTCGGGRVPLSVRCVQLDRGHPISVPHSKCSPVPKPGSFEDCSPEPCPARWKVLSLGPCSASCGLGTATQMVACMQLDQGHDNEVNETFCKALVRPQASVPCLIADCAFRWHISAWTECSVSCGDGIQRRHDTCLGPQAQVPVPANFCQHLPKPMTVRGCWAGPCA

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Cleaves the vWF multimers in plasma into smaller forms thereby controlling vWF-mediated platelet thrombus formation.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

31.3 kDa

References & Citations

"The combined roles of ADAMTS13 and VWF in murine models of TTP, endotoxemia, and thrombosis." Chauhan A.K., Walsh M.T., Zhu G., Ginsburg D., Wagner D.D., Motto D.G. Blood 111:3452-3457 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine C-X-C chemokine receptor type 2 (IL8RB) ELISA Kit
MBS7222323-01 48 Well

Bovine C-X-C chemokine receptor type 2 (IL8RB) ELISA Kit

Sign In for Pricing
View Details
Bovine C-X-C chemokine receptor type 2 (IL8RB) ELISA Kit
MBS7222323-02 96 Well

Bovine C-X-C chemokine receptor type 2 (IL8RB) ELISA Kit

Sign In for Pricing
View Details
Bovine C-X-C chemokine receptor type 2 (IL8RB) ELISA Kit
MBS7222323-03 5x 96 Well

Bovine C-X-C chemokine receptor type 2 (IL8RB) ELISA Kit

Sign In for Pricing
View Details
Bovine C-X-C chemokine receptor type 2 (IL8RB) ELISA Kit
MBS7222323-04 10x 96 Well

Bovine C-X-C chemokine receptor type 2 (IL8RB) ELISA Kit

Sign In for Pricing
View Details
Rabbit C-X-C motif chemokine 9 (CXCL9) ELISA Kit
EIA07198Rb 1 Kit

Rabbit C-X-C motif chemokine 9 (CXCL9) ELISA Kit

Sign In for Pricing
View Details
Phloroglucinol Impurity 118
RM-P081918-01 10 mg

Phloroglucinol Impurity 118

Sign In for Pricing
View Details