Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-1, Mouse

FGF-1 Protein, Mouse is a growth factor and signaling protein encoded by the FGF1 gene.

Product Specifications

Product Name Alternative

FGF-1 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-1-protein-mouse.html

Purity

98.00

Smiles

FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Molecular Formula

14164 (Gene_ID) P61148 (F16-D155) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]La Rosa S, et al. Expression of acidic fibroblast growth factor (aFGF) and fibroblast growth factor receptor 4 (FGFR4) in breast fibroadenomas. J Clin Pathol. 2001 Jan;54 (1) :37-41.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Norbuprenorphine
FN26431 1 g

Norbuprenorphine

Sign In for Pricing
View Details
MMP21 Peptide
DF7695-BP 1 mg

MMP21 Peptide

Sign In for Pricing
View Details
RPL39P5 ORF Vector (Human) (pORF)
ORF030853 1.0 µg DNA

RPL39P5 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
TNR Antibody
orb676387-01 50 µg

TNR Antibody

Sign In for Pricing
View Details
TNR Antibody
orb676387-02 100 µg

TNR Antibody

Sign In for Pricing
View Details
Etv5 3'UTR GFP Stable Cell Line
TU254133 1.0 mL

Etv5 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details