Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-1, Mouse

FGF-1 Protein, Mouse is a growth factor and signaling protein encoded by the FGF1 gene.

Product Specifications

Product Name Alternative

FGF-1 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-1-protein-mouse.html

Purity

98.00

Smiles

FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Molecular Formula

14164 (Gene_ID) P61148 (F16-D155) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]La Rosa S, et al. Expression of acidic fibroblast growth factor (aFGF) and fibroblast growth factor receptor 4 (FGFR4) in breast fibroadenomas. J Clin Pathol. 2001 Jan;54 (1) :37-41.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RND1 Protein Lysate 20ug
IHURND1PLLY20UG 20 µg

Human RND1 Protein Lysate 20ug

Sign In for Pricing
View Details
SEMA4A Rabbit Polyclonal Antibody (Cy3)
orb2587281 100 µg

SEMA4A Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
OPCML Antibody, Biotin conjugated
CSB-PA621799LD01HU-01 50 μL

OPCML Antibody, Biotin conjugated

Sign In for Pricing
View Details
OPCML Antibody, Biotin conjugated
CSB-PA621799LD01HU-02 100 µL

OPCML Antibody, Biotin conjugated

Sign In for Pricing
View Details
Tcte3 3'UTR GFP Stable Cell Line
TU170315 1.0 mL

Tcte3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
DUX4, ID (DUX4, DUX10, Double homeobox protein 4, Double homeobox protein 10, Double homeobox protein 4/10) (PE) discontinued
034867-PE 200 µL

DUX4, ID (DUX4, DUX10, Double homeobox protein 4, Double homeobox protein 10, Double homeobox protein 4/10) (PE) discontinued

Sign In for Pricing
View Details