Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GCGR, Human (HEK293, N-His, C-Myc)

The GCGR protein is a glucagon G protein-coupled receptor that is critical in blood glucose regulation and actively controls hepatic glucose production. It promotes glycogen hydrolysis and gluconeogenesis, which are critical for the fasting response. GCGR Protein, Human (HEK293, N-His, C-Myc) is the recombinant human-derived GCGR protein, expressed by HEK293 , with C-Myc, N-10*His labeled tag.

Product Specifications

Product Name Alternative

GCGR Protein, Human (HEK293, N-His, C-Myc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gcgr-protein-human-hek293-n-his-c-myc.html

Purity

97.0

Smiles

AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK

Molecular Formula

2642 (Gene_ID) P47871 (A26-K136) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAR4 Rabbit Polyclonal Antibody
orb783328-01 50 μL

PAR4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PAR4 Rabbit Polyclonal Antibody
orb783328-02 100 µL

PAR4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PAR4 Rabbit Polyclonal Antibody
orb783328-03 200 µL

PAR4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OR1D5 (h) -PR
sc-93705-PR 10 µM - 20 µL

OR1D5 (h) -PR

Sign In for Pricing
View Details
NOX4 Antibody
orb3160061-01 50 µL

NOX4 Antibody

Sign In for Pricing
View Details
NOX4 Antibody
orb3160061-02 100 µL

NOX4 Antibody

Sign In for Pricing
View Details