Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dendroaspis angusticeps Dendrotoxin B, partial

Product Specifications

Product Name Alternative

(DTX-B)

Abbreviation

Recombinant Dendroaspis angusticeps Dendrotoxin B protein, partial

UniProt

Q9PS09

Expression Region

1-30aa

Organism

Dendroaspis angusticeps (Eastern green mamba) (Naja angusticeps)

Target Sequence

MICYSHKTPQPSATIGCEEKTCYKKSVRKL

Tag

N-terminal 6xHis-KSI-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Blocks voltage-gated potassium channels (Kv) . This is the slowly inactivating phase of potassium efflux which is blocked by this toxin.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.8 kDa

References & Citations

"Purification and partial characterization of K+ channel blockers from the venom of Dendroaspis angusticeps." Chaki S., Muramatsu M., Ushiyama Y., Otomo S. Neurochem. Int. 20:553-558 (1992)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AHCYL2 Protein Vector (Mouse) (pPB-C-His)
PV153178 500 ng

AHCYL2 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
SPA-1 shRNA (h) Lentiviral Particles
sc-45418-V 200 µL

SPA-1 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
TIGIT Mouse Monoclonal Antibody [Clone ID: LBI9A12]
AMM20988VCF 100 µg

TIGIT Mouse Monoclonal Antibody [Clone ID: LBI9A12]

Sign In for Pricing
View Details
Recombinant Human AOX1 Protein, N-His
bs-105949P-01 20 µg

Recombinant Human AOX1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human AOX1 Protein, N-His
bs-105949P-02 50 µg

Recombinant Human AOX1 Protein, N-His

Sign In for Pricing
View Details
2-[ (4-nitrophenyl) thio]propanoic acid
sc-340735 250 mg

2-[ (4-nitrophenyl) thio]propanoic acid

Sign In for Pricing
View Details