Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Trichoderma harzianum Endo-1,4-beta-xylanase

Product Specifications

Product Name Alternative

Xylanase;1,4-beta-D-xylan xylanohydrolase

Abbreviation

Recombinant Trichoderma harzianum Endo-1,4-beta-xylanase protein

UniProt

P48793

Expression Region

1-190aa

Organism

Trichoderma harzianum (Hypocrea lixii)

Target Sequence

QTIGPGTGYSNGYYYSYWNDGHAGVTYTNGGGGSFTVNWSNSGNFVAGKGWQPGTKNKVINFSGSYNPNGNSYLSIYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWASHGLTLGTMDYQIVAVEGYFSSGSASITVS

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Fluoroephedrone-d3 Hydrochloride (1.0mg/ml in Acetonitrile)
TRC-KIT4765-1X1ML 1 mL

4-Fluoroephedrone-d3 Hydrochloride (1.0mg/ml in Acetonitrile)

Sign In for Pricing
View Details
Recombinant CDT1 Antibody
RC-16422-01 50 μL

Recombinant CDT1 Antibody

Sign In for Pricing
View Details
Recombinant CDT1 Antibody
RC-16422-02 100 µL

Recombinant CDT1 Antibody

Sign In for Pricing
View Details
Recombinant CDT1 Antibody
RC-16422-03 1 mL

Recombinant CDT1 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS804436 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2559R), CF488A conjugate, 0.1mg/mL
BNC882559-500 1x 500 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2559R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details