EGF, Mouse (N-His)
EGF Protein, a growth factor, is essential for cell growth, proliferation, and differentiation. It binds to the EGF receptor, activating signaling pathways that regulate cell survival and tissue repair. EGF Protein has therapeutic potential in promoting wound healing, tissue regeneration, and cancer treatment. Its role in cellular processes makes it a subject of interest in biomedical research. EGF Protein, Mouse (His) is the recombinant mouse-derived EGF protein, expressed by E. coli , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
EGF Protein, Mouse (N-His), Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/egf-protein-mouse-n-his.html
Purity
96.00
Smiles
NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR
Molecular Formula
13645 (Gene_ID) P01132 (N977-R1029) (Accession)
Molecular Weight
Approximately 9 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Nei Endonuclease VIII Like Protein 1 (NEIL1) Antibody
Nfatc2ip sgRNA CRISPR Lentivector (Mouse) (Target 3)
THRB (Thyroid Hormone Receptor beta, Nuclear Receptor Subfamily 1 group A Member 2, c-erbA-2, c-erbA-beta, THRB, ERBA2, NR1A2, THR1) (Biotin)
THRB (Thyroid Hormone Receptor beta, Nuclear Receptor Subfamily 1 group A Member 2, c-erbA-2, c-erbA-beta, THRB, ERBA2, NR1A2, THR1) (Biotin)