Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EGF, Mouse (N-His)

EGF Protein, a growth factor, is essential for cell growth, proliferation, and differentiation. It binds to the EGF receptor, activating signaling pathways that regulate cell survival and tissue repair. EGF Protein has therapeutic potential in promoting wound healing, tissue regeneration, and cancer treatment. Its role in cellular processes makes it a subject of interest in biomedical research. EGF Protein, Mouse (His) is the recombinant mouse-derived EGF protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

EGF Protein, Mouse (N-His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/egf-protein-mouse-n-his.html

Purity

96.00

Smiles

NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

Molecular Formula

13645 (Gene_ID) P01132 (N977-R1029) (Accession)

Molecular Weight

Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CFI ELISA Kit (Human)
OKCD09558-96W 96 Well

CFI ELISA Kit (Human)

Sign In for Pricing
View Details
Histone H4 Rabbit mAb
E60M1873 100 µL

Histone H4 Rabbit mAb

Sign In for Pricing
View Details
Anti-LMO7DN Antibody Picoband®, PE Conjugate
A19130-PE 100 µg/Vial

Anti-LMO7DN Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
AMFR Antibody, Biotin conjugated
A50795-100UG 100 µg

AMFR Antibody, Biotin conjugated

Sign In for Pricing
View Details
Goat Cytochrome b c1 complex subunit 7 (UQCRB) ELISA Kit
GTR10318757 96 Well

Goat Cytochrome b c1 complex subunit 7 (UQCRB) ELISA Kit

Sign In for Pricing
View Details
Nori® Human NGF-B ELISA Kit
GR111421 96 Well

Nori® Human NGF-B ELISA Kit

Sign In for Pricing
View Details