Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EGF, Mouse (N-His)

EGF Protein, a growth factor, is essential for cell growth, proliferation, and differentiation. It binds to the EGF receptor, activating signaling pathways that regulate cell survival and tissue repair. EGF Protein has therapeutic potential in promoting wound healing, tissue regeneration, and cancer treatment. Its role in cellular processes makes it a subject of interest in biomedical research. EGF Protein, Mouse (His) is the recombinant mouse-derived EGF protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

EGF Protein, Mouse (N-His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/egf-protein-mouse-n-his.html

Purity

96.00

Smiles

NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

Molecular Formula

13645 (Gene_ID) P01132 (N977-R1029) (Accession)

Molecular Weight

Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IDH2 Mouse Monoclonal Antibody (Fluoro594)
orb3085842 100 µg

IDH2 Mouse Monoclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
Recombinant Serine/Threonine Kinase 3 (STK3)
SIPH679Mu02-01 10 µg

Recombinant Serine/Threonine Kinase 3 (STK3)

Sign In for Pricing
View Details
Recombinant Serine/Threonine Kinase 3 (STK3)
SIPH679Mu02-02 50 µg

Recombinant Serine/Threonine Kinase 3 (STK3)

Sign In for Pricing
View Details
Recombinant Serine/Threonine Kinase 3 (STK3)
SIPH679Mu02-03 200 µg

Recombinant Serine/Threonine Kinase 3 (STK3)

Sign In for Pricing
View Details
Recombinant Serine/Threonine Kinase 3 (STK3)
SIPH679Mu02-04 1 mg

Recombinant Serine/Threonine Kinase 3 (STK3)

Sign In for Pricing
View Details
Recombinant Serine/Threonine Kinase 3 (STK3)
SIPH679Mu02-05 5 mg

Recombinant Serine/Threonine Kinase 3 (STK3)

Sign In for Pricing
View Details