Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAT3, Human (His)

STAT3 is a signal transducer and transcriptional activator that coordinates diverse cellular processes in response to growth factors and cytokines such as interleukin-6 and KITLG/SCF. Upon activation, STAT3 recruits coactivators to target gene promoters, thereby affecting proliferation, differentiation, and immune responses. STAT3 Protein, Human (His) is the recombinant human-derived STAT3 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

STAT3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/stat3-protein-human-his.html

Purity

98.0

Smiles

MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFN

Molecular Formula

6774 (Gene_ID) P40763-1 (M1-N175) (Accession)

Molecular Weight

20&45-47 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGS11 rabbit pAb
E28PN5171 100 µL

RGS11 rabbit pAb

Sign In for Pricing
View Details
AKT1/3 (Phospho-Tyr437/434) Antibody
MBS852576-01 0.1 mg

AKT1/3 (Phospho-Tyr437/434) Antibody

Sign In for Pricing
View Details
AKT1/3 (Phospho-Tyr437/434) Antibody
MBS852576-02 0.1 mL (AF635)

AKT1/3 (Phospho-Tyr437/434) Antibody

Sign In for Pricing
View Details
AKT1/3 (Phospho-Tyr437/434) Antibody
MBS852576-03 0.1 mL (AF610)

AKT1/3 (Phospho-Tyr437/434) Antibody

Sign In for Pricing
View Details
AKT1/3 (Phospho-Tyr437/434) Antibody
MBS852576-04 0.1 mL (AF405S)

AKT1/3 (Phospho-Tyr437/434) Antibody

Sign In for Pricing
View Details
AKT1/3 (Phospho-Tyr437/434) Antibody
MBS852576-05 0.1 mL (AF405L)

AKT1/3 (Phospho-Tyr437/434) Antibody

Sign In for Pricing
View Details